Lineage for d2yrxa1 (2yrx A:1-101)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470135Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2470136Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2470597Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. 2470598Protein automated matches [226903] (39 species)
    not a true protein
  7. 2470672Species Geobacillus kaustophilus [TaxId:1462] [255709] (4 PDB entries)
  8. 2470673Domain d2yrxa1: 2yrx A:1-101 [244806]
    Other proteins in same PDB: d2yrxa2, d2yrxa3, d2yrxa4
    automated match to d1gsoa2
    complexed with amp, po4

Details for d2yrxa1

PDB Entry: 2yrx (more details), 1.9 Å

PDB Description: Crystal structure of GAR synthetase from Geobacillus kaustophilus
PDB Compounds: (A:) Phosphoribosylglycinamide synthetase

SCOPe Domain Sequences for d2yrxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yrxa1 c.30.1.0 (A:1-101) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
mnvlvigrggrehaiawkaaqsplvgklyvapgnpgiadvaelvhideldiealvqfakq
qaidltivgpeaplasgivdrfmaeglrifgpsqraalieg

SCOPe Domain Coordinates for d2yrxa1:

Click to download the PDB-style file with coordinates for d2yrxa1.
(The format of our PDB-style files is described here.)

Timeline for d2yrxa1: