Lineage for d2yroa1 (2yro A:8-149)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2780893Species Human (Homo sapiens) [TaxId:9606] [187655] (109 PDB entries)
  8. 2781107Domain d2yroa1: 2yro A:8-149 [244802]
    Other proteins in same PDB: d2yroa2, d2yroa3
    automated match to d3nv1a_

Details for d2yroa1

PDB Entry: 2yro (more details)

PDB Description: solution structure of the c-terminal gal-bind lectin protein from human galectin-8
PDB Compounds: (A:) Galectin-8

SCOPe Domain Sequences for d2yroa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yroa1 b.29.1.0 (A:8-149) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pksgtpqlslpfaarlntpmgpgrtvvvkgevnanaksfnvdllagkskdialhlnprln
ikafvrnsflqeswgeeernitsfpfspgmyfemiiycdvrefkvavngvhsleykhrfk
elssidtleingdihllevrsw

SCOPe Domain Coordinates for d2yroa1:

Click to download the PDB-style file with coordinates for d2yroa1.
(The format of our PDB-style files is described here.)

Timeline for d2yroa1: