Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (70 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187655] (109 PDB entries) |
Domain d2yroa1: 2yro A:8-149 [244802] Other proteins in same PDB: d2yroa2, d2yroa3 automated match to d3nv1a_ |
PDB Entry: 2yro (more details)
SCOPe Domain Sequences for d2yroa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yroa1 b.29.1.0 (A:8-149) automated matches {Human (Homo sapiens) [TaxId: 9606]} pksgtpqlslpfaarlntpmgpgrtvvvkgevnanaksfnvdllagkskdialhlnprln ikafvrnsflqeswgeeernitsfpfspgmyfemiiycdvrefkvavngvhsleykhrfk elssidtleingdihllevrsw
Timeline for d2yroa1: