PDB entry 2yro

View 2yro on RCSB PDB site
Description: Solution structure of the C-terminal Gal-bind lectin protein from Human Galectin-8
Class: sugar binding protein
Keywords: Gal-bind lectin, galectin, sugar binding, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SUGAR BINDING PROTEIN
Deposited on 2007-04-02, released 2008-02-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galectin-8
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS8
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00214 (7-148)
      • expression tag (0-6)
      • expression tag (149-154)
    Domains in SCOPe 2.08: d2yroa1, d2yroa2, d2yroa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2yroA (A:)
gssgssgpksgtpqlslpfaarlntpmgpgrtvvvkgevnanaksfnvdllagkskdial
hlnprlnikafvrnsflqeswgeeernitsfpfspgmyfemiiycdvrefkvavngvhsl
eykhrfkelssidtleingdihllevrswsgpssg