SCOPe 2.05: Domain d2yjea1: 2yje A:147-372

Lineage for d2yjea1 (2yje A:147-372)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein automated matches [226905] (12 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225126] (9 PDB entries)

8. Domain d2yjea1: 2yje A:147-372 [244772]
   Other proteins in same PDB: d2yjeb1, d2yjec1
   automated match to d1c0fa2
   complexed with atp, lab, mg

Details for d2yjea1

PDB Entry: 2yje, 3.1 Å

PDB Description: oligomeric assembly of actin bound to mrtf-a

PDB Compounds: (A:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d2yjea1:

Sequence; same for both SEQRES and ATOM records:

>d2yjea1 c.55.1.1 (A:147-372) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhr

Timeline for d2yjea1:

• d2yjea1 first appeared in SCOPe 2.04
  
• d2yjea1 appears in SCOPe 2.06
  
• d2yjea1 appears in the current release, SCOPe 2.08