SCOPe 2.08: Domain d2xura1: 2xur A:1-122

Lineage for d2xura1 (2xur A:1-122)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.0: automated matches [227185] (1 protein)
   not a true family

6. Protein automated matches [226907] (28 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [255692] (2 PDB entries)

8. Domain d2xura1: 2xur A:1-122 [244585]
   automated match to d4k3la1
   mutant

Details for d2xura1

PDB Entry: 2xur, 1.9 Å

PDB Description: the g157c mutation in the escherichia coli sliding clamp specifically affects initiation of replication

PDB Compounds: (A:) DNA polymerase III subunit beta

SCOPe Domain Sequences for d2xura1:

Sequence; same for both SEQRES and ATOM records:

>d2xura1 d.131.1.0 (A:1-122) automated matches {Escherichia coli [TaxId: 562]}
mkftverehllkplqqvsgplggrptlpilgnlllqvadgtlsltgtdlememvarvalv
qphepgattvparkffdicrglpegaeiavqlegermlvrsgrsrfslstlpaadfpnld
dw

Timeline for d2xura1:

• d2xura1 first appeared in SCOPe 2.04
  
• d2xura1 appears in SCOPe 2.07