SCOP 1.71: Domain d1bi0_3: 1bi0 148-226

Lineage for d1bi0_3 (1bi0 148-226)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.34: SH3-like barrel [50036] (15 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (3 families)
   the N-terminal domains of these repressors bind DNA

5. Family b.34.1.2: Iron-dependent regulator [50041] (2 proteins)

6. Protein Diphtheria toxin repressor (DtxR) [50042] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [50043] (14 PDB entries)

8. Domain d1bi0_3: 1bi0 148-226 [24453]
   Other proteins in same PDB: d1bi0_1, d1bi0_2
   complexed with so4, zn

Details for d1bi0_3

PDB Entry: 1bi0, 2.3 Å

PDB Description: structure of apo-and holo-diphtheria toxin repressor

SCOP Domain Sequences for d1bi0_3:

Sequence, based on SEQRES records:

>d1bi0_3 b.34.1.2 (148-226) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
pgtrvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdrdghitlshn
gkdvellddlahtirieel

Sequence, based on observed residues (ATOM records):

>d1bi0_3 b.34.1.2 (148-226) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
pgtrvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdrhitlshngk
dvellddlahtirieel

Timeline for d1bi0_3:

• d1bi0_3 first appeared (with stable ids) in SCOP 1.55
  
• d1bi0_3 appears in SCOP 1.69
  
• d1bi0_3 is called d1bi0a3 in SCOP 1.73
  
• d1bi0_3 appears in the current release, SCOPe 2.08, called d1bi0a3