Lineage for d1bi0_3 (1bi0 148-226)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.34: SH3-like barrel [50036] (7 superfamilies) 
Superfamily b.34.1: C-terminal domain of biotin and diphtheria toxin repressors [50037] (2 families) 
Family b.34.1.2: Diphtheria toxin repressor (DtxR) [50041] (1 protein) Protein Diphtheria toxin repressor (DtxR) [50042] (1 species) Species Corynebacterium diphtheriae [TaxId:1717] [50043] (7 PDB entries) 
Domain d1bi0_3: 1bi0 148-226 [24453]
Other proteins in same PDB: d1bi0_1, d1bi0_2
Details for d1bi0_3
PDB Entry: 1bi0 (more details), 2.3 Å
PDB Description: structure of apo-and holo-diphtheria toxin repressor
SCOP Domain Sequences for d1bi0_3:
Sequence, based on SEQRES records: (download)
>d1bi0_3 b.34.1.2 (148-226) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
pgtrvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdrdghitlshn
gkdvellddlahtirieel
Sequence, based on observed residues (ATOM records): (download)
>d1bi0_3 b.34.1.2 (148-226) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
pgtrvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdrhitlshngk
dvellddlahtirieel
SCOP Domain Coordinates for d1bi0_3:
Click to download the PDB-style file with coordinates for d1bi0_3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bi0_3:
- d1bi0_3 appears in SCOP 1.57
- d1bi0_3 appears in the current release, SCOPe 2.08, called d1bi0a3
View in 3D
