Class b: All beta proteins [48724] (178 folds) |
Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) probable carbohydrate-binding domain in enzymes acting on sugars |
Family b.30.5.10: Rhamnogalacturonase B, RhgB, N-terminal domain [110151] (2 proteins) automatically mapped to Pfam PF09284 |
Protein automated matches [254651] (1 species) not a true protein |
Species Fungus (Aspergillus aculeatus) [TaxId:5053] [255685] (1 PDB entry) |
Domain d2xhna1: 2xhn A:1-250 [244511] Other proteins in same PDB: d2xhna2, d2xhna3, d2xhnb2, d2xhnb3 automated match to d1nkga3 complexed with ca, edo, so4; mutant |
PDB Entry: 2xhn (more details), 1.52 Å
SCOPe Domain Sequences for d2xhna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xhna1 b.30.5.10 (A:1-250) automated matches {Fungus (Aspergillus aculeatus) [TaxId: 5053]} afgittsssayvidtnapnqlkftvsrsscditsiihygtelqyssqgshigsglgsatv tatqsgdyikvtcvtdtltqymvvhngdpiihmatyitaepsigelrfiarlnsdllpne epfgdvsttadgtaiegsdvflvgsetrsafysserfiddqrhciagdahrvcmilnqye sssggpfhrdinsnnggsynalywymnsghvqtesyrmglhgpysmyfsrsgtpstsidt sffadldikg
Timeline for d2xhna1: