Lineage for d2xgqa2 (2xgq A:390-510)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008406Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology
  4. 3008407Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families) (S)
  5. 3008507Family d.240.1.0: automated matches [231323] (1 protein)
    not a true family
  6. 3008508Protein automated matches [231324] (5 species)
    not a true protein
  7. 3008509Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [231491] (7 PDB entries)
  8. 3008519Domain d2xgqa2: 2xgq A:390-510 [244508]
    Other proteins in same PDB: d2xgqa1, d2xgqa3, d2xgqb1, d2xgqb3
    automated match to d2wtfa2
    protein/DNA complex; complexed with ca

Details for d2xgqa2

PDB Entry: 2xgq (more details), 2.7 Å

PDB Description: structure of yeast dna polymerase eta in complex with c8-n-acetyl-2- aminoanthracene containing dna
PDB Compounds: (A:) DNA Polymerase ETA

SCOPe Domain Sequences for d2xgqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xgqa2 d.240.1.0 (A:390-510) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pvvksmmsnknlrgkscnsivdciswlevfcaeltsriqdleqeynkiviprtvsislkt
ksyevyrksgpvaykginfqshellkvgikfvtdldikgknksyypltklsmtitnfdii
d

SCOPe Domain Coordinates for d2xgqa2:

Click to download the PDB-style file with coordinates for d2xgqa2.
(The format of our PDB-style files is described here.)

Timeline for d2xgqa2: