SCOPe 2.06: Domain d2xaba_: 2xab A:

Lineage for d2xaba_ (2xab A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)

6. Protein automated matches [190229] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187292] (141 PDB entries)

8. Domain d2xaba_: 2xab A: [244478]
   automated match to d4egia_
   complexed with vhd

Details for d2xaba_

PDB Entry: 2xab, 1.9 Å

PDB Description: structure of hsp90 with an inhibitor bound

PDB Compounds: (A:) heat shock protein hsp 90-alpha,

SCOPe Domain Sequences for d2xaba_:

Sequence; same for both SEQRES and ATOM records:

>d2xaba_ d.122.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgke
lhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfg
vgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqt
eyleerrikeivkkhsqfigypitlfvek

Timeline for d2xaba_:

• d2xaba_ first appeared in SCOPe 2.04
  
• d2xaba_ appears in SCOPe 2.05
  
• d2xaba_ appears in SCOPe 2.07
  
• d2xaba_ appears in the current release, SCOPe 2.08