SCOPe 2.08: Domain d2xa5a1: 2xa5 A:1-306

Lineage for d2xa5a1 (2xa5 A:1-306)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein automated matches [190140] (37 species)
   not a true protein

7. Species Haemophilus influenzae [TaxId:727] [255670] (6 PDB entries)

8. Domain d2xa5a1: 2xa5 A:1-306 [244477]
   Other proteins in same PDB: d2xa5a2
   automated match to d2ceya_
   complexed with slb

Details for d2xa5a1

PDB Entry: 2xa5, 1.09 Å

PDB Description: structure of substrate binding protein siap (a11n) in complex with neu5ac

PDB Compounds: (A:) Sialic acid-binding periplasmic protein siaP

SCOPe Domain Sequences for d2xa5a1:

Sequence; same for both SEQRES and ATOM records:

>d2xa5a1 c.94.1.1 (A:1-306) automated matches {Haemophilus influenzae [TaxId: 727]}
adydlkfgmnngtssneykaaemfakevkeksqgkieislypssqlgddramlkqlkdgs
ldftfaesarfqlfypeaavfalpyvisnynvaqkalfdtefgkdlikkmdkdlgvtlls
qayngtrqttsnrainsiadmkglklrvpnaatnlayakyvgasptpmafsevylalqtn
avdgqenplaavqaqkfyevqkflamtnhilndqlylvsnetykelpedlqkvvkdaaen
aakyhtklfvdgekdlvtffekqgvkithpdlvpfkesmkpyyaefvkqtgqkgesalkq
ieainp

Timeline for d2xa5a1:

• d2xa5a1 first appeared in SCOPe 2.04, called d2xa5a_
  
• d2xa5a1 appears in SCOPe 2.07