Lineage for d1ndoe1 (1ndo E:1-154)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 372359Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 372360Superfamily b.33.1: ISP domain [50022] (2 families) (S)
  5. 372412Family b.33.1.2: Naphthalene 1,2-dioxygenase alpha subunit, N-domain [50033] (1 protein)
  6. 372413Protein Naphthalene 1,2-dioxygenase alpha subunit, N-domain [50034] (1 species)
  7. 372414Species Pseudomonas putida [TaxId:303] [50035] (8 PDB entries)
  8. 372424Domain d1ndoe1: 1ndo E:1-154 [24446]
    Other proteins in same PDB: d1ndoa2, d1ndob_, d1ndoc2, d1ndod_, d1ndoe2, d1ndof_
    complexed with fe, fes

Details for d1ndoe1

PDB Entry: 1ndo (more details), 2.25 Å

PDB Description: napthalene 1,2-dioxygenase

SCOP Domain Sequences for d1ndoe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ndoe1 b.33.1.2 (E:1-154) Naphthalene 1,2-dioxygenase alpha subunit, N-domain {Pseudomonas putida}
mnynnkilvsesglsqkhlihgdeelfqhelktifarnwlflthdslipapgdyvtakmg
idevivsrqndgsiraflnvcrhrgktlvsveagnakgfvcsyhgwgfgsngelqsvpfe
kdlygeslnkkclglkevarvesfhgfiygcfdq

SCOP Domain Coordinates for d1ndoe1:

Click to download the PDB-style file with coordinates for d1ndoe1.
(The format of our PDB-style files is described here.)

Timeline for d1ndoe1: