SCOPe 2.08: Domain d1ndoe1: 1ndo E:1-154

Lineage for d1ndoe1 (1ndo E:1-154)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (4 families)

5. Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins)

6. Protein Naphthalene 1,2-dioxygenase alpha subunit, N-domain [50034] (4 species)

7. Species Pseudomonas putida [TaxId:303] [50035] (10 PDB entries)

8. Domain d1ndoe1: 1ndo E:1-154 [24446]
   Other proteins in same PDB: d1ndoa2, d1ndob_, d1ndoc2, d1ndod_, d1ndoe2, d1ndof_
   complexed with fe, fes

Details for d1ndoe1

PDB Entry: 1ndo, 2.25 Å

PDB Description: napthalene 1,2-dioxygenase

PDB Compounds: (E:) napthalene 1,2-dioxygenase

SCOPe Domain Sequences for d1ndoe1:

Sequence; same for both SEQRES and ATOM records:

>d1ndoe1 b.33.1.2 (E:1-154) Naphthalene 1,2-dioxygenase alpha subunit, N-domain {Pseudomonas putida [TaxId: 303]}
mnynnkilvsesglsqkhlihgdeelfqhelktifarnwlflthdslipapgdyvtakmg
idevivsrqndgsiraflnvcrhrgktlvsveagnakgfvcsyhgwgfgsngelqsvpfe
kdlygeslnkkclglkevarvesfhgfiygcfdq

Timeline for d1ndoe1:

• d1ndoe1 first appeared (with stable ids) in SCOP 1.55
  
• d1ndoe1 appears in SCOPe 2.07