Class b: All beta proteins [48724] (174 folds) |
Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (4 families) |
Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins) |
Protein Naphthalene 1,2-dioxygenase alpha subunit, N-domain [50034] (2 species) |
Species Pseudomonas putida [TaxId:303] [50035] (16 PDB entries) |
Domain d1ndoa1: 1ndo A:1-154 [24444] Other proteins in same PDB: d1ndoa2, d1ndob_, d1ndoc2, d1ndod_, d1ndoe2, d1ndof_ complexed with fe, fes |
PDB Entry: 1ndo (more details), 2.25 Å
SCOPe Domain Sequences for d1ndoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ndoa1 b.33.1.2 (A:1-154) Naphthalene 1,2-dioxygenase alpha subunit, N-domain {Pseudomonas putida [TaxId: 303]} mnynnkilvsesglsqkhlihgdeelfqhelktifarnwlflthdslipapgdyvtakmg idevivsrqndgsiraflnvcrhrgktlvsveagnakgfvcsyhgwgfgsngelqsvpfe kdlygeslnkkclglkevarvesfhgfiygcfdq
Timeline for d1ndoa1: