SCOPe 2.02: Domain d1ndoa1: 1ndo A:1-154

Lineage for d1ndoa1 (1ndo A:1-154)

Root: SCOPe 2.02
Class b: All beta proteins [48724] (174 folds)

Fold b.33: ISP domain [50021] (1 superfamily)
consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

Superfamily b.33.1: ISP domain [50022] (4 families)
Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins)
Protein Naphthalene 1,2-dioxygenase alpha subunit, N-domain [50034] (2 species)
Species Pseudomonas putida [TaxId:303] [50035] (16 PDB entries)
Domain d1ndoa1: 1ndo A:1-154 [24444]
Other proteins in same PDB: d1ndoa2, d1ndob_, d1ndoc2, d1ndod_, d1ndoe2, d1ndof_
complexed with fe, fes

Details for d1ndoa1

PDB Entry: 1ndo (more details), 2.25 Å

PDB Description: napthalene 1,2-dioxygenase

PDB Compounds: (A:) napthalene 1,2-dioxygenase

SCOPe Domain Sequences for d1ndoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ndoa1 b.33.1.2 (A:1-154) Naphthalene 1,2-dioxygenase alpha subunit, N-domain {Pseudomonas putida [TaxId: 303]}
mnynnkilvsesglsqkhlihgdeelfqhelktifarnwlflthdslipapgdyvtakmg
idevivsrqndgsiraflnvcrhrgktlvsveagnakgfvcsyhgwgfgsngelqsvpfe
kdlygeslnkkclglkevarvesfhgfiygcfdq

SCOPe Domain Coordinates for d1ndoa1:

Click to download the PDB-style file with coordinates for d1ndoa1.
(The format of our PDB-style files is described here.)

Timeline for d1ndoa1: