Lineage for d2x5oa2 (2x5o A:94-297)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2511779Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2512449Superfamily c.72.2: MurD-like peptide ligases, catalytic domain [53623] (3 families) (S)
    has extra strand located between strands 1 and 2
  5. 2512450Family c.72.2.1: MurCDEF [53624] (5 proteins)
    automatically mapped to Pfam PF08245
  6. 2512480Protein automated matches [254549] (3 species)
    not a true protein
  7. 2512490Species Escherichia coli [TaxId:668369] [255650] (2 PDB entries)
  8. 2512491Domain d2x5oa2: 2x5o A:94-297 [244426]
    Other proteins in same PDB: d2x5oa1, d2x5oa3, d2x5oa4
    automated match to d4uaga3
    complexed with azi, cl, so3, so4, vsv

Details for d2x5oa2

PDB Entry: 2x5o (more details), 1.46 Å

PDB Description: discovery of novel 5-benzylidenerhodanine- and 5-benzylidene- thiazolidine-2,4-dione inhibitors of murd ligase
PDB Compounds: (A:) udp-n-acetylmuramoylalanine--d-glutamate ligase

SCOPe Domain Sequences for d2x5oa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x5oa2 c.72.2.1 (A:94-297) automated matches {Escherichia coli [TaxId: 668369]}
dielfcreaqapivaitgsngkstvttlvgemakaagvnvgvggniglpalmllddecel
yvlelssfqlettsslqavaatilnvtedhmdrypfglqqyraaklriyenakvcvvnad
daltmpirgadercvsfgvnmgdyhlnhqqgetwlrvkgekvlnvkemklsgqhnytnal
aalaladaaglprasslkalttft

SCOPe Domain Coordinates for d2x5oa2:

Click to download the PDB-style file with coordinates for d2x5oa2.
(The format of our PDB-style files is described here.)

Timeline for d2x5oa2: