SCOPe 2.07: Domain d2x5oa2: 2x5o A:94-297

Lineage for d2x5oa2 (2x5o A:94-297)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.2: MurD-like peptide ligases, catalytic domain [53623] (3 families)
   has extra strand located between strands 1 and 2

5. Family c.72.2.1: MurCDEF [53624] (5 proteins)
   automatically mapped to Pfam PF08245

6. Protein automated matches [254549] (3 species)
   not a true protein

7. Species Escherichia coli [TaxId:668369] [255650] (2 PDB entries)

8. Domain d2x5oa2: 2x5o A:94-297 [244426]
   Other proteins in same PDB: d2x5oa1, d2x5oa3, d2x5oa4
   automated match to d4uaga3
   complexed with azi, cl, so3, so4, vsv

Details for d2x5oa2

PDB Entry: 2x5o, 1.46 Å

PDB Description: discovery of novel 5-benzylidenerhodanine- and 5-benzylidene- thiazolidine-2,4-dione inhibitors of murd ligase

PDB Compounds: (A:) udp-n-acetylmuramoylalanine--d-glutamate ligase

SCOPe Domain Sequences for d2x5oa2:

Sequence; same for both SEQRES and ATOM records:

>d2x5oa2 c.72.2.1 (A:94-297) automated matches {Escherichia coli [TaxId: 668369]}
dielfcreaqapivaitgsngkstvttlvgemakaagvnvgvggniglpalmllddecel
yvlelssfqlettsslqavaatilnvtedhmdrypfglqqyraaklriyenakvcvvnad
daltmpirgadercvsfgvnmgdyhlnhqqgetwlrvkgekvlnvkemklsgqhnytnal
aalaladaaglprasslkalttft

Timeline for d2x5oa2:

• d2x5oa2 first appeared in SCOPe 2.04
  
• d2x5oa2 appears in SCOPe 2.06
  
• d2x5oa2 appears in the current release, SCOPe 2.08