SCOP 1.75: Domain d1fqtb_: 1fqt B:

Lineage for d1fqtb_ (1fqt B:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (3 families)

5. Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (8 proteins)

6. Protein Rieske-type ferredoxin associated with biphenyl dioxygenase [50031] (1 species)

7. Species Burkholderia cepacia [TaxId:292] [50032] (1 PDB entry)

8. Domain d1fqtb_: 1fqt B: [24442]
   complexed with fes, gol

Details for d1fqtb_

PDB Entry: 1fqt, 1.6 Å

PDB Description: crystal structure of the rieske-type ferredoxin associated with biphenyl dioxygenase

PDB Compounds: (B:) rieske-type ferredoxin of biphenyl dioxygenase

SCOP Domain Sequences for d1fqtb_:

Sequence; same for both SEQRES and ATOM records:

>d1fqtb_ b.33.1.1 (B:) Rieske-type ferredoxin associated with biphenyl dioxygenase {Burkholderia cepacia [TaxId: 292]}
mkftrvcdrrdvpegealkvesggtsvaifnvdgelfatqdrcthgdwslsdggylegdv
vecslhmgkfcvrtgkvkspppcealkifpiriedndvlvdfeagylap

Timeline for d1fqtb_:

• d1fqtb_ first appeared (with stable ids) in SCOP 1.55
  
• d1fqtb_ appears in SCOP 1.73
  
• d1fqtb_ appears in SCOPe 2.01
  
• d1fqtb_ appears in the current release, SCOPe 2.08