Lineage for d1fqtb_ (1fqt B:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.33: ISP domain [50021] (1 superfamily) Superfamily b.33.1: ISP domain [50022] (2 families) 
Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (4 proteins) 
Protein Rieske-type ferredoxin associated with biphenyl dioxygenase [50031] (1 species) Species Burkholderia cepacia [TaxId:292] [50032] (1 PDB entry) 
Domain d1fqtb_: 1fqt B: [24442]
Details for d1fqtb_
PDB Entry: 1fqt (more details), 1.6 Å
PDB Description: crystal structure of the rieske-type ferredoxin associated with biphenyl dioxygenase
SCOP Domain Sequences for d1fqtb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fqtb_ b.33.1.1 (B:) Rieske-type ferredoxin associated with biphenyl dioxygenase {Burkholderia cepacia}
mkftrvcdrrdvpegealkvesggtsvaifnvdgelfatqdrcthgdwslsdggylegdv
vecslhmgkfcvrtgkvkspppcealkifpiriedndvlvdfeagylap
SCOP Domain Coordinates for d1fqtb_:
Click to download the PDB-style file with coordinates for d1fqtb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fqtb_:
- d1fqtb_ appears in SCOP 1.57
- d1fqtb_ appears in the current release, SCOPe 2.08
View in 3D
