Class a: All alpha proteins [46456] (286 folds) |
Fold a.9: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47004] (1 superfamily) 3 helices; bundle, closed, right-handed twist; up-and-down |
Superfamily a.9.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47005] (2 families) |
Family a.9.1.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47006] (4 proteins) |
Protein automated matches [254439] (2 species) not a true protein |
Species Escherichia coli [TaxId:562] [254934] (4 PDB entries) |
Domain d2wxca_: 2wxc A: [244352] automated match to d1bala_ |
PDB Entry: 2wxc (more details)
SCOPe Domain Sequences for d2wxca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wxca_ a.9.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]} gsqnndalspairrllaewnldasaikgtgvggrltredvekhlaka
Timeline for d2wxca_: