Lineage for d2wxca_ (2wxc A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1725096Fold a.9: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47004] (1 superfamily)
    3 helices; bundle, closed, right-handed twist; up-and-down
  4. 1725097Superfamily a.9.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47005] (2 families) (S)
  5. 1725098Family a.9.1.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47006] (4 proteins)
  6. 1725116Protein automated matches [254439] (2 species)
    not a true protein
  7. 1725121Species Escherichia coli [TaxId:562] [254934] (4 PDB entries)
  8. 1725125Domain d2wxca_: 2wxc A: [244352]
    automated match to d1bala_

Details for d2wxca_

PDB Entry: 2wxc (more details)

PDB Description: the folding mechanism of bbl: plasticity of transition-state structure observed within an ultrafast folding protein family.
PDB Compounds: (A:) dihydrolipoyltranssuccinase

SCOPe Domain Sequences for d2wxca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wxca_ a.9.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
gsqnndalspairrllaewnldasaikgtgvggrltredvekhlaka

SCOPe Domain Coordinates for d2wxca_:

Click to download the PDB-style file with coordinates for d2wxca_.
(The format of our PDB-style files is described here.)

Timeline for d2wxca_: