SCOPe 2.05: Domain d2wqga_: 2wqg A:

Lineage for d2wqga_ (2wqg A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.140: LEM/SAP HeH motif [63450] (6 superfamilies)
   helix-extended loop-helix; parallel helices

4. Superfamily a.140.2: SAP domain [68906] (1 family)

5. Family a.140.2.1: SAP domain [68907] (8 proteins)
   Pfam PF02037

6. Protein automated matches [254644] (1 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255656] (2 PDB entries)

8. Domain d2wqga_: 2wqg A: [244210]
   automated match to d1h1js_
   mutant

Details for d2wqga_

PDB Entry: 2wqg

PDB Description: sap domain from tho1: l31w (fluorophore) mutant

PDB Compounds: (A:) protein tho1

SCOPe Domain Sequences for d2wqga_:

Sequence; same for both SEQRES and ATOM records:

>d2wqga_ a.140.2.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gsadyssltvvqlkdlltkrnlsvgglknewvqrlikddeeskgesevspq

Timeline for d2wqga_:

• d2wqga_ first appeared in SCOPe 2.04
  
• d2wqga_ appears in SCOPe 2.06
  
• d2wqga_ appears in the current release, SCOPe 2.08