Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.14: Gated ion channels [81325] (2 superfamilies) oligomeric transmembrane alpha-helical proteins |
Superfamily f.14.1: Voltage-gated potassium channels [81324] (2 families) |
Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
Protein automated matches [190184] (3 species) not a true protein |
Species Magnetospirillum magnetotacticum [TaxId:188] [229110] (4 PDB entries) |
Domain d2wlib1: 2wli B:23-138 [244172] Other proteins in same PDB: d2wlia2, d2wlib2 automated match to d2wlka1 complexed with k |
PDB Entry: 2wli (more details), 3.09 Å
SCOPe Domain Sequences for d2wlib1:
Sequence, based on SEQRES records: (download)
>d2wlib1 f.14.1.1 (B:23-138) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]} itrlglekrgwlddhyhdlltvswpvfitlitglylvtnalfalaylacgdvienarpgs ftdafffsvqtmatigygklipigplantlvtlealcgmlglavaasliyarftrp
>d2wlib1 f.14.1.1 (B:23-138) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]} itrlglddhyhdlltvswpvfitlitglylvtnalfalaylacgdvienarpgsftdaff fsvqtmatigygklipigplantlvtlealcgmlglavaasliyarftrp
Timeline for d2wlib1: