SCOPe 2.08: Domain d2wlib1: 2wli B:23-138

Lineage for d2wlib1 (2wli B:23-138)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.14: Gated ion channels [81325] (2 superfamilies)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families)
   Pfam PF00520

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)

6. Protein automated matches [190184] (3 species)
   not a true protein

7. Species Magnetospirillum magnetotacticum [TaxId:188] [229110] (5 PDB entries)

8. Domain d2wlib1: 2wli B:23-138 [244172]
   Other proteins in same PDB: d2wlia2, d2wlia3, d2wlib2, d2wlib3
   automated match to d2wlka1
   complexed with k

Details for d2wlib1

PDB Entry: 2wli, 3.09 Å

PDB Description: potassium channel from magnetospirillum magnetotacticum

PDB Compounds: (B:) kirbac3.1 potassium channel

SCOPe Domain Sequences for d2wlib1:

Sequence, based on SEQRES records:

>d2wlib1 f.14.1.1 (B:23-138) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]}
itrlglekrgwlddhyhdlltvswpvfitlitglylvtnalfalaylacgdvienarpgs
ftdafffsvqtmatigygklipigplantlvtlealcgmlglavaasliyarftrp

Sequence, based on observed residues (ATOM records):

>d2wlib1 f.14.1.1 (B:23-138) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]}
itrlglddhyhdlltvswpvfitlitglylvtnalfalaylacgdvienarpgsftdaff
fsvqtmatigygklipigplantlvtlealcgmlglavaasliyarftrp

Timeline for d2wlib1:

• d2wlib1 first appeared in SCOPe 2.04
  
• d2wlib1 appears in SCOPe 2.07