Lineage for d1qala1 (1qal A:301-725)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 945420Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 945421Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) (S)
  5. 945422Family b.30.2.1: Amine oxidase catalytic domain [49999] (2 proteins)
  6. 945423Protein Copper amine oxidase, domain 3 [50000] (4 species)
  7. 945487Species Escherichia coli [TaxId:562] [50001] (11 PDB entries)
  8. 945508Domain d1qala1: 1qal A:301-725 [24406]
    Other proteins in same PDB: d1qala2, d1qala3, d1qala4, d1qalb2, d1qalb3, d1qalb4
    complexed with ca, cu; mutant

Details for d1qala1

PDB Entry: 1qal (more details), 2.2 Å

PDB Description: the active site base controls cofactor reactivity in escherichia coli amine oxidase : x-ray crystallographic studies with mutational variants
PDB Compounds: (A:) copper amine oxidase

SCOPe Domain Sequences for d1qala1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qala1 b.30.2.1 (A:301-725) Copper amine oxidase, domain 3 {Escherichia coli [TaxId: 562]}
pavkpmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyeg
slggmivpygdpdigwyfkaylnsgdygmgtltspiargkdapsnavllnetiadytgvp
meipraiavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengti
gidagatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgen
nslvamdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnp
vsyqiipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsth
dtglgqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptl
galkk

SCOPe Domain Coordinates for d1qala1:

Click to download the PDB-style file with coordinates for d1qala1.
(The format of our PDB-style files is described here.)

Timeline for d1qala1: