Lineage for d2w4rd_ (2w4r D:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2428233Fold b.88: Mss4-like [51315] (2 superfamilies)
    complex fold made of several coiled beta-sheets
  4. 2428320Superfamily b.88.2: RIG-I C-terminal-like [254142] (2 families) (S)
    Pfam PF11648
  5. 2428321Family b.88.2.1: RIG-I C-terminal domain-like [254188] (4 proteins)
  6. 2428355Protein automated matches [254636] (1 species)
    not a true protein
  7. 2428356Species Human (Homo sapiens) [TaxId:9606] [255639] (2 PDB entries)
  8. 2428361Domain d2w4rd_: 2w4r D: [244026]
    automated match to d2rqaa_
    complexed with hg, so4

Details for d2w4rd_

PDB Entry: 2w4r (more details), 2.6 Å

PDB Description: crystal structure of the regulatory domain of human lgp2
PDB Compounds: (D:) probable ATP-dependent RNA helicase dhx58

SCOPe Domain Sequences for d2w4rd_:

Sequence, based on SEQRES records: (download)

>d2w4rd_ b.88.2.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rqqfpvehvqllcincmvavghgsdlrkvegthhvnvnpnfsnyynvsrdpvvinkvfkd
wkpggviscrncgevwglqmiyksvklpvlkvrsmlletpqgriqakkwsrvpfsvpdfd
flqhcaenlsdl

Sequence, based on observed residues (ATOM records): (download)

>d2w4rd_ b.88.2.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rqqfpvehvqllcincmvavghgsdlrkvegthhvnvnpnfsnyynvsrdfkdwkpggvi
scrncgevwglqmiyksvklpvlkvrsmlletpqgriqakkwsrvpfsvpdfdflqhcae
nlsdl

SCOPe Domain Coordinates for d2w4rd_:

Click to download the PDB-style file with coordinates for d2w4rd_.
(The format of our PDB-style files is described here.)

Timeline for d2w4rd_: