![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.88: Mss4-like [51315] (2 superfamilies) complex fold made of several coiled beta-sheets |
![]() | Superfamily b.88.2: RIG-I C-terminal-like [254142] (2 families) ![]() Pfam PF11648 |
![]() | Family b.88.2.1: RIG-I C-terminal domain-like [254188] (4 proteins) |
![]() | Protein automated matches [254636] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255639] (2 PDB entries) |
![]() | Domain d2w4rd_: 2w4r D: [244026] automated match to d2rqaa_ complexed with hg, so4 |
PDB Entry: 2w4r (more details), 2.6 Å
SCOPe Domain Sequences for d2w4rd_:
Sequence, based on SEQRES records: (download)
>d2w4rd_ b.88.2.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rqqfpvehvqllcincmvavghgsdlrkvegthhvnvnpnfsnyynvsrdpvvinkvfkd wkpggviscrncgevwglqmiyksvklpvlkvrsmlletpqgriqakkwsrvpfsvpdfd flqhcaenlsdl
>d2w4rd_ b.88.2.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rqqfpvehvqllcincmvavghgsdlrkvegthhvnvnpnfsnyynvsrdfkdwkpggvi scrncgevwglqmiyksvklpvlkvrsmlletpqgriqakkwsrvpfsvpdfdflqhcae nlsdl
Timeline for d2w4rd_: