SCOPe 2.04: Domain d2w2qe_: 2w2q E:

Lineage for d2w2qe_ (2w2q E:)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.0: automated matches [227227] (1 protein)
   not a true family

6. Protein automated matches [226968] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225423] (21 PDB entries)

8. Domain d2w2qe_: 2w2q E: [244022]
   Other proteins in same PDB: d2w2qa_
   automated match to d3bpse1
   complexed with ca; mutant

Details for d2w2qe_

PDB Entry: 2w2q, 2.33 Å

PDB Description: pcsk9-deltac d374h mutant bound to wt egf-a of ldlr

PDB Compounds: (E:) low-density lipoprotein receptor

SCOPe Domain Sequences for d2w2qe_:

Sequence; same for both SEQRES and ATOM records:

>d2w2qe_ g.3.11.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lyfqgamgtnecldnnggcshvcndlkigyeclcpdgfqlvaqrrce

Timeline for d2w2qe_:

• d2w2qe_ is new in SCOPe 2.04-stable
  
• d2w2qe_ appears in SCOPe 2.05
  
• d2w2qe_ appears in the current release, SCOPe 2.08, called d2w2qe1