Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.41: Subtilisin-like [52742] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3 |
Superfamily c.41.1: Subtilisin-like [52743] (3 families) |
Family c.41.1.0: automated matches [191390] (1 protein) not a true family |
Protein automated matches [190500] (7 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255634] (7 PDB entries) |
Domain d2w2ma_: 2w2m A: [244013] Other proteins in same PDB: d2w2me_ automated match to d1s2nb_ complexed with ca |
PDB Entry: 2w2m (more details), 2.4 Å
SCOPe Domain Sequences for d2w2ma_:
Sequence, based on SEQRES records: (download)
>d2w2ma_ c.41.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} sipwnleritppryradeyqppdggslvevylldtsiqsdhreiegrvmvtdfenvpeed gtrfhrqaskcdshgthlagvvsgrdagvakgasmrslrvlncqgkgtvsgtliglefir ksqlvqpvgplvvllplaggysrvlnaacqrlaragvvlvtaagnfrddaclyspasape vitvgatnaqdqpvtlgtlgtnfgrcvdlfapgediigassdcstcfvsqsgtsqaaahv agiaammlsaepeltlaelrqrlihfsakdvineawfpedqrvltpnlvaalpps
>d2w2ma_ c.41.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} sipwnleritpprggslvevylldtsiqsdhreiegrvmvtdfenvpeedskcdshgthl agvvsgrdagvakgasmrslrvlncqgkgtvsgtliglefirksqlvqpvgplvvllpla ggysrvlnaacqrlaragvvlvtaagnfrddaclyspasapevitvgatnaqdqpvtlgt lgtnfgrcvdlfapgediigassdcstcfvsqsgtsqaaahvagiaammlsaepeltlae lrqrlihfsakdvineawfpedqrvltpnlvaalpps
Timeline for d2w2ma_: