Lineage for d1qafb1 (1qaf B:301-726)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1119824Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 1119825Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) (S)
  5. 1119826Family b.30.2.1: Amine oxidase catalytic domain [49999] (2 proteins)
  6. 1119827Protein Copper amine oxidase, domain 3 [50000] (4 species)
  7. 1119891Species Escherichia coli [TaxId:562] [50001] (11 PDB entries)
  8. 1119903Domain d1qafb1: 1qaf B:301-726 [24401]
    Other proteins in same PDB: d1qafa2, d1qafa3, d1qafa4, d1qafb2, d1qafb3, d1qafb4
    complexed with ca, cu, gol; mutant

Details for d1qafb1

PDB Entry: 1qaf (more details), 2.2 Å

PDB Description: the active site base controls cofactor reactivity in escherichia coli amine oxidase : x-ray crystallographic studies with mutational variants
PDB Compounds: (B:) protein (copper amine oxidase)

SCOPe Domain Sequences for d1qafb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qafb1 b.30.2.1 (B:301-726) Copper amine oxidase, domain 3 {Escherichia coli [TaxId: 562]}
pavkpmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyeg
slggmivpygdpdigwyfkaylesgdygmgtltspiargkdapsnavllnetiadytgvp
meipraiavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengti
gidagatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgen
nslvamdpvvkpntaggprtstmqvnqynigneqdaaqkfdpgtirllsnpnkenrmgnp
vsyqiipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsth
dtglgqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptl
galkkd

SCOPe Domain Coordinates for d1qafb1:

Click to download the PDB-style file with coordinates for d1qafb1.
(The format of our PDB-style files is described here.)

Timeline for d1qafb1: