SCOPe 2.05: Domain d2vtda3: 2vtd A:298-440

Lineage for d2vtda3 (2vtd A:298-440)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest

4. Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (3 families)

5. Family c.59.1.0: automated matches [254241] (1 protein)
   not a true family

6. Protein automated matches [254550] (4 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [255259] (8 PDB entries)

8. Domain d2vtda3: 2vtd A:298-440 [243941]
   Other proteins in same PDB: d2vtda1, d2vtda2
   automated match to d4uaga2
   complexed with lkm, so4

Details for d2vtda3

PDB Entry: 2vtd, 1.94 Å

PDB Description: crystal structure of murd ligase in complex with d-glu containing sulfonamide inhibitor

PDB Compounds: (A:) udp-n-acetylmuramoylalanine--d-glutamate ligase

SCOPe Domain Sequences for d2vtda3:

Sequence; same for both SEQRES and ATOM records:

>d2vtda3 c.59.1.0 (A:298-440) automated matches {Escherichia coli [TaxId: 562]}
glphrfevvlehngvrwindskatnvgsteaalnglhvdgtlhlllggdgksadfsplar
ylngdnvrlycfgrdgaqlaalrpevaeqtetmeqamrllaprvqpgdmvllspacasld
qfknfeqrgnefarlakelgshh

Timeline for d2vtda3:

• d2vtda3 first appeared in SCOPe 2.04
  
• d2vtda3 appears in SCOPe 2.06
  
• d2vtda3 appears in the current release, SCOPe 2.08