Lineage for d2vtda3 (2vtd A:298-440)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1863129Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest
  4. 1863130Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (3 families) (S)
  5. 1863172Family c.59.1.0: automated matches [254241] (1 protein)
    not a true family
  6. 1863173Protein automated matches [254550] (4 species)
    not a true protein
  7. 1863174Species Escherichia coli [TaxId:562] [255259] (8 PDB entries)
  8. 1863179Domain d2vtda3: 2vtd A:298-440 [243941]
    Other proteins in same PDB: d2vtda1, d2vtda2
    automated match to d4uaga2
    complexed with lkm, so4

Details for d2vtda3

PDB Entry: 2vtd (more details), 1.94 Å

PDB Description: crystal structure of murd ligase in complex with d-glu containing sulfonamide inhibitor
PDB Compounds: (A:) udp-n-acetylmuramoylalanine--d-glutamate ligase

SCOPe Domain Sequences for d2vtda3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vtda3 c.59.1.0 (A:298-440) automated matches {Escherichia coli [TaxId: 562]}
glphrfevvlehngvrwindskatnvgsteaalnglhvdgtlhlllggdgksadfsplar
ylngdnvrlycfgrdgaqlaalrpevaeqtetmeqamrllaprvqpgdmvllspacasld
qfknfeqrgnefarlakelgshh

SCOPe Domain Coordinates for d2vtda3:

Click to download the PDB-style file with coordinates for d2vtda3.
(The format of our PDB-style files is described here.)

Timeline for d2vtda3: