Lineage for d2vpqb3 (2vpq B:330-449)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1808932Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 1809035Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) (S)
  5. 1809160Family b.84.2.0: automated matches [254217] (1 protein)
    not a true family
  6. 1809161Protein automated matches [254496] (11 species)
    not a true protein
  7. 1809203Species Staphylococcus aureus [TaxId:1280] [255619] (1 PDB entry)
  8. 1809205Domain d2vpqb3: 2vpq B:330-449 [243927]
    Other proteins in same PDB: d2vpqa1, d2vpqa2, d2vpqb1, d2vpqb2
    automated match to d1ulza1
    complexed with anp, cl, mg

Details for d2vpqb3

PDB Entry: 2vpq (more details), 2.1 Å

PDB Description: crystal structure of biotin carboxylase from s. aureus complexed with amppnp
PDB Compounds: (B:) acetyl-coa carboxylase

SCOPe Domain Sequences for d2vpqb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vpqb3 b.84.2.0 (B:330-449) automated matches {Staphylococcus aureus [TaxId: 1280]}
ltghaiefrinaenpyknfmpspgkieqylapggygvriesacytnytippyydsmvakl
iiheptrdeaimagiralsefvvlgidttipfhikllnndifrsgkfntnfleqnsimnd

SCOPe Domain Coordinates for d2vpqb3:

Click to download the PDB-style file with coordinates for d2vpqb3.
(The format of our PDB-style files is described here.)

Timeline for d2vpqb3: