SCOPe 2.05: Domain d2vpqa2: 2vpq A:115-329

Lineage for d2vpqa2 (2vpq A:115-329)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families)

5. Family d.142.1.0: automated matches [227184] (1 protein)
   not a true family

6. Protein automated matches [226904] (27 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [225146] (3 PDB entries)

8. Domain d2vpqa2: 2vpq A:115-329 [243923]
   Other proteins in same PDB: d2vpqa1, d2vpqa3, d2vpqb1, d2vpqb3
   automated match to d1ulza3
   complexed with anp, cl, mg

Details for d2vpqa2

PDB Entry: 2vpq, 2.1 Å

PDB Description: crystal structure of biotin carboxylase from s. aureus complexed with amppnp

PDB Compounds: (A:) acetyl-coa carboxylase

SCOPe Domain Sequences for d2vpqa2:

Sequence; same for both SEQRES and ATOM records:

>d2vpqa2 d.142.1.0 (A:115-329) automated matches {Staphylococcus aureus [TaxId: 1280]}
kdvakaemikanvpvvpgsdglmkdvseakkiakkigypviikataggggkgirvardek
eletgfrmteqeaqtafgngglymekfienfrhieiqivgdsygnvihlgerdctiqrrm
qklveeapspilddetrremgnaavraakavnyenagtiefiydlndnkfyfmemntriq
vehpvtemvtgidlvklqlqvamgdvlpykqedik

Timeline for d2vpqa2:

• d2vpqa2 first appeared in SCOPe 2.04
  
• d2vpqa2 appears in SCOPe 2.06
  
• d2vpqa2 appears in the current release, SCOPe 2.08