Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) |
Family d.142.1.0: automated matches [227184] (1 protein) not a true family |
Protein automated matches [226904] (27 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [225146] (3 PDB entries) |
Domain d2vpqa2: 2vpq A:115-329 [243923] Other proteins in same PDB: d2vpqa1, d2vpqa3, d2vpqb1, d2vpqb3 automated match to d1ulza3 complexed with anp, cl, mg |
PDB Entry: 2vpq (more details), 2.1 Å
SCOPe Domain Sequences for d2vpqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vpqa2 d.142.1.0 (A:115-329) automated matches {Staphylococcus aureus [TaxId: 1280]} kdvakaemikanvpvvpgsdglmkdvseakkiakkigypviikataggggkgirvardek eletgfrmteqeaqtafgngglymekfienfrhieiqivgdsygnvihlgerdctiqrrm qklveeapspilddetrremgnaavraakavnyenagtiefiydlndnkfyfmemntriq vehpvtemvtgidlvklqlqvamgdvlpykqedik
Timeline for d2vpqa2: