Lineage for d2vpia1 (2vpi A:25-219)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2858750Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2859252Family c.23.16.0: automated matches [191336] (1 protein)
    not a true family
  6. 2859253Protein automated matches [190197] (23 species)
    not a true protein
  7. 2859424Species Human (Homo sapiens) [TaxId:9606] [255618] (1 PDB entry)
  8. 2859425Domain d2vpia1: 2vpi A:25-219 [243920]
    Other proteins in same PDB: d2vpia2, d2vpib2
    automated match to d2d7ja_

Details for d2vpia1

PDB Entry: 2vpi (more details), 2.4 Å

PDB Description: human gmp synthetase - glutaminase domain
PDB Compounds: (A:) GMP synthase

SCOPe Domain Sequences for d2vpia1:

Sequence, based on SEQRES records: (download)

>d2vpia1 c.23.16.0 (A:25-219) automated matches {Human (Homo sapiens) [TaxId: 9606]}
egavvildagaqygkvidrrvrelfvqseifpletpafaikeqgfraiiisggpnsvyae
dapwfdpaiftigkpvlgicygmqmmnkvfggtvhkksvredgvfnisvdntcslfrglq
keevvllthgdsvdkvadgfkvvarsgnivagianeskklygaqfhpevgltengkvilk
nflydiagcsgtftv

Sequence, based on observed residues (ATOM records): (download)

>d2vpia1 c.23.16.0 (A:25-219) automated matches {Human (Homo sapiens) [TaxId: 9606]}
egavvildagaqygkvidrrvrelfvqseifpletpafaikeqgfraiiisgapwfdpai
ftigkpvlgicygmqmmnkvfggtvhkksvredgvfnisvdntcslfrglqkeevvllth
gdsvdkvadgfkvvarsgnivagianeskklygaqfhpevgltengkvilknflydiagc
sgtftv

SCOPe Domain Coordinates for d2vpia1:

Click to download the PDB-style file with coordinates for d2vpia1.
(The format of our PDB-style files is described here.)

Timeline for d2vpia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vpia2