SCOPe 2.08: Domain d2vpia1: 2vpi A:25-219

Lineage for d2vpia1 (2vpi A:25-219)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.0: automated matches [191336] (1 protein)
   not a true family

6. Protein automated matches [190197] (23 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255618] (1 PDB entry)

8. Domain d2vpia1: 2vpi A:25-219 [243920]
   Other proteins in same PDB: d2vpia2, d2vpib2
   automated match to d2d7ja_

Details for d2vpia1

PDB Entry: 2vpi, 2.4 Å

PDB Description: human gmp synthetase - glutaminase domain

PDB Compounds: (A:) GMP synthase

SCOPe Domain Sequences for d2vpia1:

Sequence, based on SEQRES records:

>d2vpia1 c.23.16.0 (A:25-219) automated matches {Human (Homo sapiens) [TaxId: 9606]}
egavvildagaqygkvidrrvrelfvqseifpletpafaikeqgfraiiisggpnsvyae
dapwfdpaiftigkpvlgicygmqmmnkvfggtvhkksvredgvfnisvdntcslfrglq
keevvllthgdsvdkvadgfkvvarsgnivagianeskklygaqfhpevgltengkvilk
nflydiagcsgtftv

Sequence, based on observed residues (ATOM records):

>d2vpia1 c.23.16.0 (A:25-219) automated matches {Human (Homo sapiens) [TaxId: 9606]}
egavvildagaqygkvidrrvrelfvqseifpletpafaikeqgfraiiisgapwfdpai
ftigkpvlgicygmqmmnkvfggtvhkksvredgvfnisvdntcslfrglqkeevvllth
gdsvdkvadgfkvvarsgnivagianeskklygaqfhpevgltengkvilknflydiagc
sgtftv

Timeline for d2vpia1:

• d2vpia1 first appeared in SCOPe 2.04, called d2vpia_
  
• d2vpia1 appears in SCOPe 2.07