SCOPe 2.05: Domain d2vf0a_: 2vf0 A:

Lineage for d2vf0a_ (2vf0 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein Thymidylate synthase [55833] (7 species)

7. Species Escherichia coli [TaxId:562] [55834] (64 PDB entries)

8. Domain d2vf0a_: 2vf0 A: [243863]
   automated match to d2veta_
   protein/RNA complex; complexed with f89, ndu, so4

Details for d2vf0a_

PDB Entry: 2vf0, 3 Å

PDB Description: crystal structure of the thymidylate synthase k48q complexed with 5no2dump and bw1843u89

PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d2vf0a_:

Sequence; same for both SEQRES and ATOM records:

>d2vf0a_ d.117.1.1 (A:) Thymidylate synthase {Escherichia coli [TaxId: 562]}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttqrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai

Timeline for d2vf0a_:

• d2vf0a_ first appeared in SCOPe 2.04
  
• d2vf0a_ appears in SCOPe 2.06
  
• d2vf0a_ appears in the current release, SCOPe 2.08