Lineage for d2veza_ (2vez A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1664276Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1664277Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1664807Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 1664808Protein automated matches [190038] (28 species)
    not a true protein
  7. 1664821Species Aspergillus fumigatus [TaxId:5085] [255609] (2 PDB entries)
  8. 1664822Domain d2veza_: 2vez A: [243862]
    automated match to d4ag7a_
    complexed with aco, g6p, po4

Details for d2veza_

PDB Entry: 2vez (more details), 1.45 Å

PDB Description: afgna1 crystal structure complexed with acetyl-coa and glucose-6p gives new insights into catalysis
PDB Compounds: (A:) putative glucosamine 6-phosphate acetyltransferase

SCOPe Domain Sequences for d2veza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2veza_ d.108.1.0 (A:) automated matches {Aspergillus fumigatus [TaxId: 5085]}
entplfspslispdvlavlpadytirplcrsdykrgyldvlrvlttvgdineeqwnsrye
wirarsdeyyllvvcdgegrivgtgslvverkfihslgmvghiediavekgqqgkklglr
iiqaldyvaekvgcyktildcseanegfyikcgfkraglemahyy

SCOPe Domain Coordinates for d2veza_:

Click to download the PDB-style file with coordinates for d2veza_.
(The format of our PDB-style files is described here.)

Timeline for d2veza_: