Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore automatically mapped to Pfam PF00502 |
Protein automated matches [190531] (20 species) not a true protein |
Species Leptolyngbya sp. [TaxId:47254] [255594] (1 PDB entry) |
Domain d2uunq_: 2uun Q: [243815] automated match to d1gh0a_ complexed with bla, cyc |
PDB Entry: 2uun (more details), 3 Å
SCOPe Domain Sequences for d2uunq_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uunq_ a.1.1.3 (Q:) automated matches {Leptolyngbya sp. [TaxId: 47254]} mktpltdavstadsqgrflssteiqvafgrfrqaaaglsaataltsaadalisgaaqavy nsfpyttcmqgpnyaadqrgkdkcardigyylrmvtycliaggtgpmdeyliagidevnr tfelspswyiealkyikanhglagdaaaeansyldyainals
Timeline for d2uunq_: