Lineage for d2rrma_ (2rrm A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1785878Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 1785879Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 1785880Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 1786174Protein automated matches [190055] (6 species)
    not a true protein
  7. 1786257Species Mouse (Mus musculus) [TaxId:10090] [189198] (6 PDB entries)
  8. 1786270Domain d2rrma_: 2rrm A: [243760]
    automated match to d2h2ba_

Details for d2rrma_

PDB Entry: 2rrm (more details)

PDB Description: Interplay between phosphatidyl-inositol-phosphates and claudins upon binding to the 1st PDZ domain of zonula occludens 1
PDB Compounds: (A:) Tight junction protein ZO-1

SCOPe Domain Sequences for d2rrma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rrma_ b.36.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gplgsdhiweqhtvtlhrapgfgfgiaisggrdnphfqsgetsivisdvlkggpaegqlq
endrvamvngvsmdnvehafavqqlrksgknakitirrkk

SCOPe Domain Coordinates for d2rrma_:

Click to download the PDB-style file with coordinates for d2rrma_.
(The format of our PDB-style files is described here.)

Timeline for d2rrma_: