SCOPe 2.08: Domain d2rrma1: 2rrm A:1-93

Lineage for d2rrma1 (2rrm A:1-93)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein automated matches [190055] (6 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [189198] (6 PDB entries)

8. Domain d2rrma1: 2rrm A:1-93 [243760]
   Other proteins in same PDB: d2rrma2
   automated match to d2h2ba_

Details for d2rrma1

PDB Entry: 2rrm

PDB Description: Interplay between phosphatidyl-inositol-phosphates and claudins upon binding to the 1st PDZ domain of zonula occludens 1

PDB Compounds: (A:) Tight junction protein ZO-1

SCOPe Domain Sequences for d2rrma1:

Sequence; same for both SEQRES and ATOM records:

>d2rrma1 b.36.1.1 (A:1-93) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iweqhtvtlhrapgfgfgiaisggrdnphfqsgetsivisdvlkggpaegqlqendrvam
vngvsmdnvehafavqqlrksgknakitirrkk

Timeline for d2rrma1:

• d2rrma1 first appeared in SCOPe 2.04, called d2rrma_
  
• d2rrma1 appears in SCOPe 2.07