Class b: All beta proteins [48724] (177 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) |
Family b.34.9.0: automated matches [191625] (1 protein) not a true family |
Protein automated matches [191144] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189286] (21 PDB entries) |
Domain d2rjda1: 2rjd A:204-313 [243711] automated match to d1oz3a1 |
PDB Entry: 2rjd (more details), 1.65 Å
SCOPe Domain Sequences for d2rjda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rjda1 b.34.9.0 (A:204-313) automated matches {Human (Homo sapiens) [TaxId: 9606]} ecwswesyleeqkaitapvslfqdsqavthnkngfklgmklegidpqhpsmyfiltvaev cgyrlrlhfdgysechdfwvnanspdihpagwfektghklqppkgykeee
Timeline for d2rjda1: