Lineage for d2rjca3 (2rjc A:422-518)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2394116Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2394399Family b.34.9.0: automated matches [191625] (1 protein)
    not a true family
  6. 2394400Protein automated matches [191144] (3 species)
    not a true protein
  7. 2394415Species Human (Homo sapiens) [TaxId:9606] [189286] (22 PDB entries)
  8. 2394434Domain d2rjca3: 2rjc A:422-518 [243704]
    automated match to d1oz3a3
    protein/DNA complex; complexed with mes, so4

Details for d2rjca3

PDB Entry: 2rjc (more details), 2 Å

PDB Description: Crystal structure of L3MBTL1 protein in complex with MES
PDB Compounds: (A:) Lethal(3)malignant brain tumor-like protein

SCOPe Domain Sequences for d2rjca3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rjca3 b.34.9.0 (A:422-518) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fcwekyleetgasavptwafkvrpphsflvnmkleavdrrnpalirvasvedvedhriki
hfdgwshgydfwidadhpdihpagwcsktghplqppl

SCOPe Domain Coordinates for d2rjca3:

Click to download the PDB-style file with coordinates for d2rjca3.
(The format of our PDB-style files is described here.)

Timeline for d2rjca3: