| Class b: All beta proteins [48724] (178 folds) | 
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix  | 
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) ![]()  | 
| Family b.34.9.0: automated matches [191625] (1 protein) not a true family  | 
| Protein automated matches [191144] (3 species) not a true protein  | 
| Species Human (Homo sapiens) [TaxId:9606] [189286] (22 PDB entries) | 
| Domain d2rhza2: 2rhz A:314-421 [243688] Other proteins in same PDB: d2rhza4 automated match to d1oz2a2 complexed with peg; mutant  | 
PDB Entry: 2rhz (more details), 2.2 Å
SCOPe Domain Sequences for d2rhza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rhza2 b.34.9.0 (A:314-421) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fswsqylrstraqaapkhlfvsqshsppplgfqvgmkleavnrmnpslvcvasvtdvvds
rflvhfdnwddtydywcdpsspyihpvgwcqkqgkpltppqdypdpdn
Timeline for d2rhza2: