SCOPe 2.07: Domain d2qieh_: 2qie H:

Lineage for d2qieh_ (2qie H:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.5: Molybdopterin synthase subunit MoaE [54690] (2 families)

5. Family d.41.5.0: automated matches [191646] (1 protein)
   not a true family

6. Protein automated matches [191185] (6 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [255555] (2 PDB entries)

8. Domain d2qieh_: 2qie H: [243581]
   automated match to d2wp4a_
   complexed with 8cs

Details for d2qieh_

PDB Entry: 2qie, 2.5 Å

PDB Description: staphylococcus aureus molybdopterin synthase in complex with precursor z

PDB Compounds: (H:) Molybdopterin-converting factor subunit 2

SCOPe Domain Sequences for d2qieh_:

Sequence, based on SEQRES records:

>d2qieh_ d.41.5.0 (H:) automated matches {Staphylococcus aureus [TaxId: 1280]}
mkqfeiviepiqteqyreftineyqgavvvftghvrewtkgvkteyleyeayipmaekkl
aqigdeinekwpgtitsivhrigplqisdiavliavssphrkdayraneyaierikeivp
iwkkeiwedgskwqgh

Sequence, based on observed residues (ATOM records):

>d2qieh_ d.41.5.0 (H:) automated matches {Staphylococcus aureus [TaxId: 1280]}
mkqfeiviepiqteqyreftineyqgavvvftghvrewtkgvkteyleyeayipmaekkl
aqigdeinekwpgtitsivhrigplqisdiavliavssphrkdayraneyaierikeivp
iwkkeikwqgh

Timeline for d2qieh_:

• d2qieh_ first appeared in SCOPe 2.04
  
• d2qieh_ appears in SCOPe 2.06
  
• d2qieh_ appears in the current release, SCOPe 2.08