Lineage for d2q58a_ (2q58 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014347Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2014348Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2014755Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2014756Protein automated matches [196409] (37 species)
    not a true protein
  7. 2014785Species Cryptosporidium parvum [TaxId:353152] [255554] (1 PDB entry)
  8. 2014786Domain d2q58a_: 2q58 A: [243521]
    automated match to d3b7la_
    complexed with mg, zol

Details for d2q58a_

PDB Entry: 2q58 (more details), 2.37 Å

PDB Description: cryptosporidium parvum putative polyprenyl pyrophosphate synthase (cgd4_2550) in complex with zoledronate
PDB Compounds: (A:) farnesyl pyrophosphate synthase

SCOPe Domain Sequences for d2q58a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q58a_ a.128.1.0 (A:) automated matches {Cryptosporidium parvum [TaxId: 353152]}
ydytdfinyydkfkvivynvlkklplndeirkpvieyylncidynvkkgkhirgkilvli
sslssaysnikrdsiyllgwvveaiqaliliaddimdsgkfrrgapcwyivhgqsnaind
ifflkmlslslifelssvfgndivmkiqkiynesifftvlgqhldlsyfdlskadkiser
yfsmvemktsrytfympvffgltlseiqvssaqlnlieailyklgefyqvhndvsdylfn
dsnaddicrfkltwplqksfeiadeemklkisenygknsslvkdcynllkinehyleyqr
naldyliklvkditddslqkvfihlihqiselitn

SCOPe Domain Coordinates for d2q58a_:

Click to download the PDB-style file with coordinates for d2q58a_.
(The format of our PDB-style files is described here.)

Timeline for d2q58a_: