Lineage for d2pfja_ (2pfj A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2490159Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2490160Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2490381Family c.52.1.17: Endonuclease I (Holliday junction resolvase) [53029] (2 proteins)
    automatically mapped to Pfam PF05367
  6. 2490396Protein automated matches [254622] (2 species)
    not a true protein
  7. 2490408Species Enterobacteria phage [TaxId:10760] [255546] (1 PDB entry)
  8. 2490409Domain d2pfja_: 2pfj A: [243476]
    automated match to d1m0da_
    protein/DNA complex; complexed with ca

Details for d2pfja_

PDB Entry: 2pfj (more details), 3.1 Å

PDB Description: crystal structure of t7 endo i resolvase in complex with a holliday junction
PDB Compounds: (A:) Endodeoxyribonuclease 1

SCOPe Domain Sequences for d2pfja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pfja_ c.52.1.17 (A:) automated matches {Enterobacteria phage [TaxId: 10760]}
sgledkvskqleskgikfeyeewkvpyvipasnhtytpdfllpngifvetaglwesddrk
khllireqhpeldirivfsssrtklykgsptsygefcekhgikfadklipaewikepkke
vpfdrlkrk

SCOPe Domain Coordinates for d2pfja_:

Click to download the PDB-style file with coordinates for d2pfja_.
(The format of our PDB-style files is described here.)

Timeline for d2pfja_: