Lineage for d2nlra_ (2nlr A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 459805Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 459806Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) (S)
  5. 460534Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)
  6. 460535Protein Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain [49991] (7 species)
  7. 460553Species Streptomyces lividans, CelB2 [TaxId:1916] [49992] (2 PDB entries)
  8. 460554Domain d2nlra_: 2nlr A: [24344]

Details for d2nlra_

PDB Entry: 2nlr (more details), 1.2 Å

PDB Description: streptomyces lividans endoglucanase (ec: 3.2.1.4) complex with modified glucose trimer

SCOP Domain Sequences for d2nlra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nlra_ b.29.1.11 (A:) Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain {Streptomyces lividans, CelB2}
dtticepfgtttiqgryvvqnnrwgstapqcvtatdtgfrvtqadgsaptngapksypsv
fngchytncspgtdlpvrldtvsaapssisygfvdgavynasydiwldptartdgvnqte
imiwfnrvgpiqpigspvgtasvggrtwevwsggngsndvlsfvapsaisgwsfdvmdfv
ratvarglaendwyltsvqagfepwqngaglavnsfsstvet

SCOP Domain Coordinates for d2nlra_:

Click to download the PDB-style file with coordinates for d2nlra_.
(The format of our PDB-style files is described here.)

Timeline for d2nlra_: