Lineage for d2nlra_ (2nlr A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) 
Family b.29.1.11: Xylanase/endoglucanase 12 [49978] (2 proteins) Protein Endo-1,4-beta-glucanase (cellulase) CelB2 catalytic domain [49991] (1 species) Species Streptomyces lividans [TaxId:1916] [49992] (2 PDB entries) 
Domain d2nlra_: 2nlr A: [24344]
Details for d2nlra_
PDB Entry: 2nlr (more details), 1.2 Å
PDB Description: streptomyces lividans endoglucanase (ec: 3.2.1.4) complex with modified glucose trimer
SCOP Domain Sequences for d2nlra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nlra_ b.29.1.11 (A:) Endo-1,4-beta-glucanase (cellulase) CelB2 catalytic domain {Streptomyces lividans}
dtticepfgtttiqgryvvqnnrwgstapqcvtatdtgfrvtqadgsaptngapksypsv
fngchytncspgtdlpvrldtvsaapssisygfvdgavynasydiwldptartdgvnqte
imiwfnrvgpiqpigspvgtasvggrtwevwsggngsndvlsfvapsaisgwsfdvmdfv
ratvarglaendwyltsvqagfepwqngaglavnsfsstvet
SCOP Domain Coordinates for d2nlra_:
Click to download the PDB-style file with coordinates for d2nlra_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2nlra_:
- d2nlra_ appears in SCOP 1.57
- d2nlra_ appears in the current release, SCOPe 2.08
View in 3D