Lineage for d1ukrc_ (1ukr C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2389728Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2389773Protein Xylanase II [49979] (21 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 2389780Species Aspergillus niger [TaxId:5061] [49987] (1 PDB entry)
  8. 2389783Domain d1ukrc_: 1ukr C: [24338]

Details for d1ukrc_

PDB Entry: 1ukr (more details), 2.4 Å

PDB Description: structure of endo-1,4-beta-xylanase c
PDB Compounds: (C:) endo-1,4-b-xylanase I

SCOPe Domain Sequences for d1ukrc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ukrc_ b.29.1.11 (C:) Xylanase II {Aspergillus niger [TaxId: 5061]}
ginyvqnyngnlgdftydesagtfsmywedgvssdfvvglgwttgssnaitysaeysasg
sasylavygwvnypqaeyyivedygdynpcssatslgtvysdgstyqvctdtrtnepsit
gtstftqyfsvrestrtsgtvtvanhfnfwahhgfgnsdfnyqvvaveawsgagsasvti
s

SCOPe Domain Coordinates for d1ukrc_:

Click to download the PDB-style file with coordinates for d1ukrc_.
(The format of our PDB-style files is described here.)

Timeline for d1ukrc_: