SCOPe 2.07: Domain d2obva3: 2obv A:252-395

Lineage for d2obva3 (2obv A:252-395)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
   duplication: consists of 3 similar intertwined domains
   structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta

4. Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families)

5. Family d.130.1.0: automated matches [254267] (1 protein)
   not a true family

6. Protein automated matches [254617] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255522] (26 PDB entries)

8. Domain d2obva3: 2obv A:252-395 [243313]
   Other proteins in same PDB: d2obva4
   automated match to d2p02a3
   complexed with na, pg4, sam

Details for d2obva3

PDB Entry: 2obv, 2.05 Å

PDB Description: crystal structure of the human s-adenosylmethionine synthetase 1 in complex with the product

PDB Compounds: (A:) S-adenosylmethionine synthetase isoform type-1

SCOPe Domain Sequences for d2obva3:

Sequence; same for both SEQRES and ATOM records:

>d2obva3 d.130.1.0 (A:252-395) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iggpqgdagvtgrkiivdtyggwgahgggafsgkdytkvdrsaayaarwvakslvkaglc
rrvlvqvsyaigvaeplsisiftygtsqkterelldvvhknfdlrpgvivrdldlkkpiy
qktacyghfgrsefpwevprklvf

Timeline for d2obva3:

• d2obva3 first appeared in SCOPe 2.04
  
• d2obva3 appears in SCOPe 2.06
  
• d2obva3 appears in the current release, SCOPe 2.08