Lineage for d1redb_ (1red B:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 108496Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 108497Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (12 families) (S)
  5. 109001Family b.29.1.11: Xylanase/endoglucanase 12 [49978] (2 proteins)
  6. 109013Protein Xylanase II [49979] (12 species)
  7. 109053Species Trichoderma reesei, xynII [TaxId:51453] [49985] (6 PDB entries)
  8. 109061Domain d1redb_: 1red B: [24330]

Details for d1redb_

PDB Entry: 1red (more details), 1.6 Å

PDB Description: endo-1,4-beta-xylanase ii complex with 4,5-epoxypentyl-beta-d-xyloside

SCOP Domain Sequences for d1redb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1redb_ b.29.1.11 (B:) Xylanase II {Trichoderma reesei, xynII}
etiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvi
nfsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrt
qrvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyf
ssgsasitvs

SCOP Domain Coordinates for d1redb_:

Click to download the PDB-style file with coordinates for d1redb_.
(The format of our PDB-style files is described here.)

Timeline for d1redb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1reda_