SCOPe 2.04: Domain d2o28a_: 2o28 A:

Lineage for d2o28a_ (2o28 A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225745] (14 PDB entries)

8. Domain d2o28a_: 2o28 A: [243281]
   automated match to d2huza_
   complexed with 16g, coa

Details for d2o28a_

PDB Entry: 2o28, 1.8 Å

PDB Description: crystal structure of gnpnat1

PDB Compounds: (A:) Glucosamine 6-phosphate N-acetyltransferase

SCOPe Domain Sequences for d2o28a_:

Sequence; same for both SEQRES and ATOM records:

>d2o28a_ d.108.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pdetpmfdpsllkevdwsqntatfspaispthpgeglvlrplctadlnrgffkvlgqlte
tgvvspeqfmksfehmkksgdyyvtvvedvtlgqivatatliiehkfihscakrgrvedv
vvsdecrgkqlgklllstltllskklncykitleclpqnvgfykkfgytvseenymcrrf
lk

Timeline for d2o28a_:

• d2o28a_ is new in SCOPe 2.04-stable
  
• d2o28a_ appears in SCOPe 2.05
  
• d2o28a_ appears in the current release, SCOPe 2.08