SCOPe 2.07: Domain d1xypa1: 1xyp A:2-190

Lineage for d1xypa1 (1xyp A:2-190)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein Xylanase II [49979] (21 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Trichoderma reesei, xynII [TaxId:51453] [49985] (16 PDB entries)

8. Domain d1xypa1: 1xyp A:2-190 [24327]
   Other proteins in same PDB: d1xypa2, d1xypb2

Details for d1xypa1

PDB Entry: 1xyp, 1.5 Å

PDB Description: structural comparison of two major endo-1,4-beta-xylanases from trichodrema reesei

PDB Compounds: (A:) endo-1,4-beta-xylanase II

SCOPe Domain Sequences for d1xypa1:

Sequence; same for both SEQRES and ATOM records:

>d1xypa1 b.29.1.11 (A:2-190) Xylanase II {Trichoderma reesei, xynII [TaxId: 51453]}
tiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvin
fsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrtq
rvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyfs
sgsasitvs

Timeline for d1xypa1:

• d1xypa1 first appeared (with stable ids) in SCOP 1.55, called d1xypa_
  
• d1xypa1 appears in SCOPe 2.06
  
• d1xypa1 appears in the current release, SCOPe 2.08