![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
![]() | Protein automated matches [226839] (52 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [224896] (58 PDB entries) |
![]() | Domain d2nzta4: 2nzt A:671-913 [243253] automated match to d1czan4 complexed with bg6, glc, unx |
PDB Entry: 2nzt (more details), 2.45 Å
SCOPe Domain Sequences for d2nzta4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nzta4 c.55.1.0 (A:671-913) automated matches {Human (Homo sapiens) [TaxId: 9606]} hcevglivgtgsnacymeemrnvelvegeegrmcvnmewgafgdngclddfrtefdvavd elslnpgkqrfekmisgmylgeivrnilidftkrgllfrgriserlktrgifetkflsqi esdclallqvrailqhlglestcddsiivkevctvvarraaqlcgagmaavvdrirenrg ldalkvtvgvdgtlyklhphfakvmhetvkdlapkcdvsflqsedgsgkgaalitavacr ire
Timeline for d2nzta4:
![]() Domains from other chains: (mouse over for more information) d2nztb1, d2nztb2, d2nztb3, d2nztb4 |