Lineage for d1xyn__ (1xyn -)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (12 families) 
Family b.29.1.11: Xylanase/endoglucanase 12 [49978] (2 proteins) 
Protein Xylanase II [49979] (12 species) 
Species Trichoderma reesei, xynI [TaxId:51453] [49984] (1 PDB entry) 
Domain d1xyn__: 1xyn - [24322]
Details for d1xyn__
PDB Entry: 1xyn (more details), 2 Å
PDB Description: structural comparison of two major endo-1,4-beta-xylanases from trichodrema reesei
SCOP Domain Sequences for d1xyn__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xyn__ b.29.1.11 (-) Xylanase II {Trichoderma reesei, xynI}
asinydqnyqtggqvsyspsntgfsvnwntqddfvvgvgwttgssapinfggsfsvnsgt
gllsvygwstnplveyyimednhnypaqgtvkgtvtsdgatytiwentrvnepsiqgtat
fnqyisvrnsprtsgtvtvqnhfnawaslglhlgqmnyqvvavegwggsgsasqsvsn
SCOP Domain Coordinates for d1xyn__:
Click to download the PDB-style file with coordinates for d1xyn__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1xyn__:
- d1xyn__ first appeared (with stable ids) in SCOP 1.55
- d1xyn__ appears in SCOP 1.57
- d1xyn__ appears in SCOP 1.61
- d1xyn__ appears in the current release, SCOPe 2.08, called d1xyna_
View in 3D